ZNF690 (ZSCAN29) Rabbit Polyclonal Antibody

SKU TA345544

Rabbit Polyclonal Anti-ZSCAN29 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZSCAN29 antibody is: synthetic peptide directed towards the C-terminal region of Human ZSCAN29. Synthetic peptide located within the following region: SSDLRAHHRTHTGEKPYGCHDCGKCFSKSSALNKHGEIHAREKLLTQSAP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: zinc finger and SCAN domain containing 29
• Database Link:
  NP_689668
  Q8IWY8
• Background: ZSCAN29 may be involved in transcriptional regulation.
• Synonyms: Zfp690; ZNF690
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79%

Reference Data