ZNF689 Rabbit Polyclonal Antibody

SKU TA345499

Rabbit Polyclonal Anti-ZNF689 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF689 antibody: synthetic peptide directed towards the N terminal of human ZNF689. Synthetic peptide located within the following region: MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: zinc finger protein 689
• Database Link:
  NP_612456
  Q96CS4
• Background: ZNF689 may be involved in transcriptional regulation.
• Synonyms: TIPUH1
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 86%; Pig: 79%; Bovine: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transcription Factors