ZNF431 Rabbit Polyclonal Antibody

SKU
TA345493
Rabbit Polyclonal Anti-ZNF431 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF431 antibody: synthetic peptide directed towards the N terminal of human ZNF431. Synthetic peptide located within the following region: MDDLKYGVYPLKEASGCPGAERNLLVYSYFEKETLTFRDVAIEFSLEEWE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 67 kDa
Gene Name zinc finger protein 431
Database Link
Background ZNF431 may be involved in transcriptional regulation.
Synonyms DKFZp313E0830; KIAA1969
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Write Your Own Review
You're reviewing:ZNF431 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.