ZNF257 Rabbit Polyclonal Antibody

SKU TA345482

Rabbit Polyclonal Anti-ZNF257 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF257 antibody: synthetic peptide directed towards the C terminal of human ZNF257. Synthetic peptide located within the following region: HLSQHKIIHTGEKPYKCEECGKPFNRFSYLTVHKRIHAGENPNKYEECGK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 66 kDa
• Gene Name: zinc finger protein 257
• Database Link:
  NP_258429
  Q9Y2Q1
• Background: The function of ZNF257 has not yet been determined.
• Synonyms: BMZF-4; BMZF4
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 90%; Horse: 77%; Mouse: 77%

Reference Data

• Protein Families: Transcription Factors