BTBD6 Rabbit Polyclonal Antibody

SKU TA345479

Rabbit Polyclonal Anti-BTBD6 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BTBD6 antibody: synthetic peptide directed towards the N terminal of human BTBD6. Synthetic peptide located within the following region: FVVGPPGATRTVPAHKYVLAVGSSVFYAMFYGDLAEVKSEIHIPDVEPAA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: BTB domain containing 6
• Database Link:
  NP_150374
  Q96KE9
• Background: The function remains unknown.
• Synonyms: BDPL
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 86%; Pig: 79%; Horse: 79%; Rabbit: 79%; Zebrafish: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome