HSFY1 Rabbit Polyclonal Antibody

SKU
TA345471
Rabbit Polyclonal Anti-HSFY1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HSFY1 antibody: synthetic peptide directed towards the N terminal of human HSFY1. Synthetic peptide located within the following region: MAHVSSETQDVSPKDELTASEASTRSPLCEHTFPGDSDLRSMIEEHAFQV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 45 kDa
Gene Name heat shock transcription factor, Y-linked 1
Database Link
Background HSFY1 is a member of the heat shock factor (HSF) family of transcriptional activators for heat shock proteins. This gene is a candidate gene for azoospermia, since it localizes to a region of chromosome Y that is sometimes deleted in infertile males. The
Synonyms HSF2L; HSFY
Note Immunogen Sequence Homology: Human: 100%; Dog: 92%; Horse: 77%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:HSFY1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.