CPXCR1 Rabbit Polyclonal Antibody

SKU
TA345469
Rabbit Polyclonal Anti-CPXCR1 Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CPXCR1 antibody: synthetic peptide directed towards the N terminal of human CPXCR1. Synthetic peptide located within the following region: SDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 35 kDa
Gene Name CPX chromosome region, candidate 1
Database Link
Background The function remains unknown.
Synonyms CT77
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Write Your Own Review
You're reviewing:CPXCR1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.