ZNF382 Rabbit Polyclonal Antibody

SKU TA345459

Rabbit Polyclonal Anti-ZNF382 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF382 antibody: synthetic peptide directed towards the N terminal of human ZNF382. Synthetic peptide located within the following region: MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVMLENYCHFVSVGFHM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: zinc finger protein 382
• Database Link:
  NP_116214
  Q96SR6
• Background: Members of the C2H2 zinc finger transcription factor family, such as ZNF382, play key roles in the regulation of cell proliferation, differentiation, and apoptosis in response to a variety of stimuli.Members of the C2H2 zinc finger transcription factor family, such as ZNF382, play key roles in the regulation of cell proliferation, differentiation, and apoptosis in response to a variety of stimuli (Gebelein et al., 1998). [supplied by OMIM]
• Synonyms: KS1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Rabbit: 92%

Reference Data

• Protein Families: Transcription Factors