ZNF419A (ZNF419) Rabbit Polyclonal Antibody

SKU TA345394

Rabbit Polyclonal Anti-ZNF419 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF419 antibody: synthetic peptide directed towards the N terminal of human ZNF419. Synthetic peptide located within the following region: AAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRLL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: zinc finger protein 419
• Database Link:
  NP_078967
  Q96HQ0
• Background: ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. NF419A may be involved in transcriptional regulation.
• Synonyms: ZAPHIR; ZNF419A
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Horse: 83%

Reference Data

• Protein Families: Transcription Factors