WSTF (BAZ1B) Rabbit Polyclonal Antibody

CAT#: TA345371

Rabbit Polyclonal Anti-BAZ1B Antibody

Product Images

WB Suggested Anti-BAZ1B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysateBAZ1B is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BAZ1B antibody: synthetic peptide directed towards the middle region of human BAZ1B. Synthetic peptide located within the following region: EQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 171 kDa
• Gene Name: bromodomain adjacent to zinc finger domain 1B
• Database Link:
  NP_115784
  Entrez Gene 9031 Human
  UniProt ID Q9UIG0
• Background: BAZ1B is a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: WBSCR9; WBSCR10; WSTF
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Horse: 86%; Guinea pig: 86%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors