ZNFN1A4 (IKZF4) Rabbit Polyclonal Antibody

SKU TA345363

Rabbit Polyclonal Anti-IKZF4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IKZF4 antibody: synthetic peptide directed towards the n terminal of human IKZF4. Synthetic peptide located within the following region: GSHRQGKDNLERDPSGGCVPDFLPQAQDSNHFIMESLFCESSGDSSLEKE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: IKAROS family zinc finger 4
• Database Link:
  NP_071910
  Q9H2S9
• Background: Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development.Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-436 AC034102.32 139959-140394 c 437-975 DA797441.1 1-539 976-5506 BX647761.1 546-5076
• Synonyms: EOS; ZNFN1A4
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%

Reference Data

• Protein Families: Transcription Factors