PRDM13 Rabbit Polyclonal Antibody

CAT#: TA345336

Rabbit Polyclonal Anti-PRDM13 Antibody


 Product Datasheet for 'TA345336'

USD 360.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PRDM13 antibody: synthetic peptide directed towards the N terminal of human PRDM13. Synthetic peptide located within the following region: HGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRM
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Predicted Protein Size 74 kDa
Gene Name PR domain 13
Background PRDM13 may be involved in transcriptional regulation.
Synonyms MU-MB-20.220; PFM10
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 86%; Rabbit: 79%
Reference Data
Other products for "PRDM13"
Frequently bought together (2)
Transient overexpression lysate of PR domain containing 13 (PRDM13)
    • 100 ug

USD 495.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
40% off proteins and antibodies
68 Mouse Clones