PRDM13 Rabbit Polyclonal Antibody

SKU
TA345336
Rabbit Polyclonal Anti-PRDM13 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-PRDM13 antibody: synthetic peptide directed towards the N terminal of human PRDM13. Synthetic peptide located within the following region: HGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 74 kDa
Gene Name PR domain 13
Database Link
Background PRDM13 may be involved in transcriptional regulation.
Synonyms MU-MB-20.220; PFM10
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 86%; Rabbit: 79%
Reference Data
Write Your Own Review
You're reviewing:PRDM13 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.