ZNF317 Rabbit Polyclonal Antibody

SKU TA345309

Rabbit Polyclonal Anti-ZNF317 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF317 antibody: synthetic peptide directed towards the C terminal of human ZNF317. Synthetic peptide located within the following region: HRRIHTGEKPYECLVCGKAFSDHSSLRSHVKTHRGEKLFVSSVWKRLQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: zinc finger protein 317
• Database Link:
  NP_065984
  Q96PQ6
• Background: ZNF317 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers and 1 KRAB domain. ZNF317 may function as a transcription factor. It may play an important role in erythroid maturation and lymphoid proliferation.
• Synonyms: KIAA1588
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Horse: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Transcription Factors