ZNF415 Rabbit Polyclonal Antibody

SKU TA345249

Rabbit Polyclonal Anti-ZNF415 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF415 antibody: synthetic peptide directed towards the N terminal of human ZNF415. Synthetic peptide located within the following region: MAFTQLTFRDVAIEFSQDEWKCLNSTQRTLYRDVMLENYRNLVSLDLSRN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: zinc finger protein 415
• Database Link:
  NP_060825
  Q09FC8
• Background: ZNF415 is involved in transcriptional regulation. The transcriptional activity differed among the various isoforms. All isoforms except isoform 3 seem to suppress the transcriptional activities of AP-1 and p53.
• Synonyms: ZfLp
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Sheep: 93%; Bovine: 93%

Reference Data

• Protein Families: Transcription Factors