KLHL26 Rabbit Polyclonal Antibody

CAT#: TA345247

Rabbit Polyclonal Anti-KLHL26 Antibody


 Product Datasheet for 'TA345247'

USD 300.00


Availability*
5 Days

Size
    • 100 ug


Product images

Specifications

Product Data
Applications WB, IHC
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-KLHL26 antibody: synthetic peptide directed towards the C terminal of human KLHL26. Synthetic peptide located within the following region: EAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAG
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Predicted Protein Size 68kDa
Gene Name kelch like family member 26
Background The function of KLHL26 remains unknown.
Synonyms -
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Other products for "KLHL26"
Frequently bought together (3)
Transient overexpression lysate of kelch-like 26 (Drosophila) (KLHL26)
    • 100 ug

USD 315.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 150.00


Mouse monoclonal anti-GAPDH antibody, clone 2D9, Loading, clone OTI2D9 (formerly 2D9)
    • 30 ul

USD 150.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies