KLHL26 Rabbit Polyclonal Antibody

CAT#: TA345247

Reviews ()
Write a review

Rabbit Polyclonal Anti-KLHL26 Antibody


Product Datasheet for 'TA345247'


Promo! Get it for USD 289.00, only with code 289*.

(*) Valid from April 1st to September 30th, 2020. See details »

USD 310.00


Availability*
5 Days

Size
    • 100 ul


Product images

Specifications

Product Data
Applications IHC, WB
Recommended Dilution WB
Reactivity Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-KLHL26 antibody: synthetic peptide directed towards the C terminal of human KLHL26. Synthetic peptide located within the following region: EAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Predicted Protein Size 68 kDa
Gene Name kelch like family member 26
Background The function of KLHL26 remains unknown.
Synonyms FLJ11078
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 93%
Reference Data
Other products for "KLHL26"
Frequently bought together (3)
Recombinant protein of human kelch-like 26 (Drosophila) (KLHL26)
    • 20 ug

USD 748.00


Transient overexpression lysate of kelch-like 26 (Drosophila) (KLHL26)
    • 100 ug

USD 325.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 159.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Antibody Performance Guarantee banner
ANTIBODY VALIDATION 101
Clone ID reveals the Source of Monoclonal Antibodies