SNX7 Rabbit Polyclonal Antibody

SKU TA345085

Rabbit Polyclonal Anti-SNX7 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNX7 antibody: synthetic peptide directed towards the middle region of human SNX7. Synthetic peptide located within the following region: LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: sorting nexin 7
• Database Link:
  NP_057060
  Q9UNH6
• Background: This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region like some family members, and its exact function is unknown. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 11. [provided by RefSeq, Jun 2010]
• Synonyms: DKFZp564F052; MGC8717
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 92%; Guinea pig: 92%

Reference Data