MED31 Rabbit Polyclonal Antibody

SKU TA345072

Rabbit Polyclonal Anti-MED31 Antibody - C-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Med31 antibody is: synthetic peptide directed towards the C-terminal region of Rat Med31. Synthetic peptide located within the following region: YEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNTTAG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 14 kDa
• Gene Name: mediator complex subunit 31
• Database Link:
  NP_057144
  Q9Y3C7
• Background: The function of this protein remains unknown.
• Synonyms: 3110004H13Rik; CGI-125; Soh1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors