HECA Rabbit Polyclonal Antibody

CAT#: TA345054

Rabbit Polyclonal Anti-HECA Antibody - middle region

Product Images

WB Suggested Anti-HECA Antibody Titration: 0.2-1 ug/ml; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HECA antibody: synthetic peptide directed towards the middle region of human HECA. Synthetic peptide located within the following region: HKLNTFHVRMEDDAQVGQGEDLRKFILAALSASHRNVVNCALCHRALPVF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 59 kDa
• Gene Name: hdc homolog, cell cycle regulator
• Database Link:
  NP_057301
  Entrez Gene 51696 Human
  UniProt ID Q9UBI9
• Background: This gene encodes the homolog of the Drosophila headcase protein, a highly basic, cytoplasmic protein that regulates the re-entry of imaginal cells into the mitotic cycle during adult morphogenesis. In Drosophila, the encoded protein also inhibits terminal branching of neighboring cells during tracheal development. [provided by RefSeq, Jul 2008]
• Synonyms: dJ225E12.1; HDC; HDCL; HHDC
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 93%; Guinea pig: 86%