epsilon Tubulin (TUBE1) Rabbit Polyclonal Antibody

CAT#: TA345047

Rabbit Polyclonal Anti-TUBE1 Antibody - middle region


USD 539.00

5 Days*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of tubulin, epsilon 1 (TUBE1)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human tubulin, epsilon 1 (TUBE1), 20 µg
    • 20 ug

USD 867.00

Other products for "epsilon Tubulin"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: PSGEDDVITSPYNSILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 53 kDa
Gene Name tubulin epsilon 1
Background This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization of the microtubules during centriole duplication. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Jan 2009]
Synonyms dJ142L7.2; TUBE
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Rat: 93%; Mouse: 93%; Zebrafish: 93%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.