epsilon Tubulin (TUBE1) Rabbit Polyclonal Antibody

CAT#: TA345046

Rabbit Polyclonal Anti-TUBE1 Antibody - middle region

Product Images

WB Suggested Anti-TUBE1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Hela cell lysate

• 

  Drosophila Melanogaster brain

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Drosophila, Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TUBE1 antibody: synthetic peptide directed towards the middle region of human TUBE1. Synthetic peptide located within the following region: HLHHYLQVEGMEESCFTEAVSSLSALIQEYDQLDATKNMPVQDLPRLSIA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: tubulin epsilon 1
• Database Link:
  NP_057346
  Entrez Gene 51175 Human
  UniProt ID Q9UJT0
• Background: This gene encodes a member of the tubulin superfamily. This protein localizes to the centriolar sub-distal appendages that are associated with the older of the two centrioles after centrosome duplication. This protein plays a central role in organization of the microtubules during centriole duplication. A pseudogene of this gene is found on chromosome 5. [provided by RefSeq, Jan 2009]
• Synonyms: dJ142L7.2; TUBE
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rabbit: 93%; Horse: 86%; Dog: 85%

Reference Data

• Protein Families: Druggable Genome