COMMD8 Rabbit Polyclonal Antibody

CAT#: TA344959

Rabbit Polyclonal Anti-COMMD8 Antibody - middle region

Product Images

WB Suggested Anti-COMMD8 Antibody Titration: 0.2-1 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COMMD8 antibody: synthetic peptide directed towards the middle region of human COMMD8. Synthetic peptide located within the following region: IAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: COMM domain containing 8
• Database Link:
  NP_060315
  Entrez Gene 54951 Human
  UniProt ID Q9NX08
• Background: The function of COMMD8 remains unknown.
• Synonyms: FLJ20502
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Dog: 86%; Rat: 86%; Rabbit: 86%; Yeast: 83%; Mouse: 79%; Bovine: 79%