C9orf95 (NMRK1) Rabbit Polyclonal Antibody

SKU
TA344957
Rabbit Polyclonal Anti-C9orf95 Antibody - N-terminal region
$585.00
2 Weeks*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-C9orf95 antibody: synthetic peptide directed towards the N terminal of human C9orf95. Synthetic peptide located within the following region: QDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAISCWMESARHSVVST
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 23 kDa
Gene Name nicotinamide riboside kinase 1
Database Link
Background The function of C9orf95 remains unknown.
Synonyms bA235O14.2; C9orf95; NRK1
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 79%; Mouse: 79%; Zebrafish: 75%
Reference Data
Protein Pathways Nicotinate and nicotinamide metabolism
Write Your Own Review
You're reviewing:C9orf95 (NMRK1) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.