TESC Rabbit Polyclonal Antibody
Frequently bought together (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 200.00
Other products for "TESC"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-TESC antibody is: synthetic peptide directed towards the C-terminal region of Human TESC. Synthetic peptide located within the following region: DSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQME |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 23 kDa |
Gene Name | tescalcin |
Database Link | |
Background | TESC functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na+/H+ exchange activity. It promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane and promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. It is essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. It is also involved in granulocytic differentiation in a ERK-dependent manner and inhibits the phosphatase activity of calcineurin. |
Synonyms | CHP3; TSC |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 77% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.