TESC Rabbit Polyclonal Antibody

CAT#: TA344953

Rabbit Polyclonal Anti-TESC Antibody - C-terminal region


USD 539.00

Backordered*

Size
    • 100 ul

Product Images

Frequently bought together (3)
Transient overexpression lysate of tescalcin (TESC), transcript variant 1
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00


Recombinant protein of human tescalcin (TESC), 20 µg
    • 20 ug

USD 867.00

Other products for "TESC"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-TESC antibody is: synthetic peptide directed towards the C-terminal region of Human TESC. Synthetic peptide located within the following region: DSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQME
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 23 kDa
Gene Name tescalcin
Background TESC functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na+/H+ exchange activity. It promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane and promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. It is essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. It is also involved in granulocytic differentiation in a ERK-dependent manner and inhibits the phosphatase activity of calcineurin.
Synonyms CHP3; TSC
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.