FTSJD1 (CMTR2) Rabbit Polyclonal Antibody

SKU TA344872

Rabbit Polyclonal Anti-FTSJD1 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FTSJD1 antibody: synthetic peptide directed towards the middle region of human FTSJD1. Synthetic peptide located within the following region: TKWFGQRNKYFKTYNERKMLEALSWKDKVAKGYFNSWAEEHGVYHPGQSS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 88 kDa
• Gene Name: cap methyltransferase 2
• Database Link:
  NP_060818
  Q8IYT2
• Background: The function of this protein remains unknown.
• Synonyms: AFT; FTSJD1; HMTr2; MTr2
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%; Yeast: 77%

Reference Data