CCDC76 (TRMT13) Rabbit Polyclonal Antibody

SKU TA344820

Rabbit Polyclonal Anti-CCDC76 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CCDC76 antibody: synthetic peptide directed towards the N terminal of human CCDC76. Synthetic peptide located within the following region: QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: tRNA methyltransferase 13 homolog
• Database Link:
  NP_061956
  Q9NUP7
• Background: CCDC76 specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.
• Synonyms: CCDC76
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Guinea pig: 92%; Rabbit: 85%

Reference Data