FEM 1C (FEM1C) Rabbit Polyclonal Antibody

CAT#: TA344805

Rabbit Polyclonal Anti-FEM1C Antibody - C-terminal region

Product Images

Host: Rabbit; Target Name: Fem1c; Sample Tissue: Rat Kidney lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Fem1c antibody is: synthetic peptide directed towards the C-terminal region of Rat Fem1c. Synthetic peptide located within the following region: LHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGNIPEK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: fem-1 homolog C
• Database Link:
  NP_064562
  Entrez Gene 302288 Rat
  UniProt ID Q96JP0
• Background: The function of this protein remains unknown.
• Synonyms: EUROIMAGE686608; EUROIMAGE783647; FEM1A
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%