FEM 1C (FEM1C) Rabbit Polyclonal Antibody

SKU TA344805

Rabbit Polyclonal Anti-FEM1C Antibody - C-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Fem1c antibody is: synthetic peptide directed towards the C-terminal region of Rat Fem1c. Synthetic peptide located within the following region: LHKQTASDLLDEKEIAKNLIQPINHTTLQCLAARVIVNHRIYYKGNIPEK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 67 kDa
• Gene Name: fem-1 homolog C
• Database Link:
  NP_064562
  Q96JP0
• Background: The function of this protein remains unknown.
• Synonyms: EUROIMAGE686608; EUROIMAGE783647; FEM1A
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data