PDXP Rabbit Polyclonal Antibody

SKU TA344797

Rabbit Polyclonal Anti-PDXP Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PDXP antibody: synthetic peptide directed towards the middle region of human PDXP. Synthetic peptide located within the following region: DPWHPLSDGSRTPGTGSLAAAVETASGRQALVVGKPSPYMFECITENFSI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: pyridoxal phosphatase
• Database Link:
  NP_064711
  Q96GD0
• Background: Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP.Pyridoxal 5-prime-phosphate (PLP) is the active form of vitamin B6 that acts as a coenzyme in maintaining biochemical homeostasis. The preferred degradation route from PLP to 4-pyridoxic acid involves the dephosphorylation of PLP by PDXP (Jang et al., 2003 [PubMed 14522954]). [supplied by OMIM]
• Synonyms: CIN; dJ37E16.5; PLP
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%

Reference Data

• Protein Pathways: Metabolic pathways, Vitamin B6 metabolism