DENND1A Rabbit Polyclonal Antibody

CAT#: TA344747

Rabbit Polyclonal Anti-DENND1A Antibody

Product Images

WB Suggested Anti-DENND1A Antibody Titration: 0.2-1 ug/ml; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DENND1A antibody: synthetic peptide directed towards the N terminal of human DENND1A. Synthetic peptide located within the following region: PGVSVHLSVHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASML
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 110 kDa
• Gene Name: DENN domain containing 1A
• Database Link:
  NP_065997
  Entrez Gene 57706 Human
  UniProt ID Q8TEH3
• Background: DENND1A may be involved in the clathrin-mediated endocytosis of synaptic vesicles.
• Synonyms: FAM31A; KIAA1608
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 93%; Horse: 80%