C14orf133 (VIPAS39) Rabbit Polyclonal Antibody

SKU TA344706

Rabbit Polyclonal Anti-VIPAR Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-VIPAR antibody: synthetic peptide directed towards the middle region of human VIPAR. Synthetic peptide located within the following region: VEDVDTKLNLATKFKCHDVVIDTYRDLKDRQQLLAYRSKVDKGSAEEEKI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: VPS33B interacting protein, apical-basolateral polarity regulator, spe-39 homolog
• Database Link:
  NP_071350
  Q9H9C1
• Background: The function of this protein remains unknown.
• Synonyms: C14orf133; hSPE-39; SPE-39; SPE39; VIPAR; VPS16B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 86%

Reference Data