GREM2 Rabbit Polyclonal Antibody
Rabbit Polyclonal Anti-GREM2 Antibody - N-terminal region
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GREM2 antibody: synthetic peptide directed towards the N terminal of human GREM2. Synthetic peptide located within the following region: MFWKLSLSLFLVAVLVKVAEARKNRPAGAIPSPYKDGSSNNSERWQHQIK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 17 kDa |
Gene Name | gremlin 2, DAN family BMP antagonist |
Database Link | |
Background | This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. |
Synonyms | CKTSF1B2; DAND3; PRDC |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93% |
Reference Data | |
Protein Families | Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Antibody Resources |
Other products for "GREM2"
Customer
Reviews
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.