ATPAF1 Rabbit Polyclonal Antibody

SKU
TA344673
Rabbit Polyclonal Anti-ATPAF1 Antibody - N-terminal region
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ATPAF1 antibody: synthetic peptide directed towards the N terminal of human ATPAF1. Synthetic peptide located within the following region: GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKI
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 29 kDa
Gene Name ATP synthase mitochondrial F1 complex assembly factor 1
Database Link
Background This gene encodes an assembly factor for the F(1) component of the mitochondrial ATP synthase. This protein binds specifically to the F1 beta subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. Alternatively spliced transcript variants have been identified, but the biological validity of some of these variants has not been determined.
Synonyms ATP11; ATP11p
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Mouse: 93%; Bovine: 93%; Pig: 86%; Rat: 86%; Guinea pig: 86%; Rabbit: 79%
Reference Data
Write Your Own Review
You're reviewing:ATPAF1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.