ASB3 Rabbit Polyclonal Antibody

SKU TA344629

Rabbit Polyclonal Anti-ASB3 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ASB3 antibody: synthetic peptide directed towards the middle region of human ASB3. Synthetic peptide located within the following region: LEIRSSLKSERLRSDSYISQLPLPRSLHNYLLYEDVLRMYEVPELAAIQD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 49 kDa
• Gene Name: ankyrin repeat and SOCS box containing 3
• Database Link:
  NP_665862
  Q9Y575
• Background: The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants have been described for this gene but some of the full length sequences are not known.
• Synonyms: ASB-3
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Guinea pig: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome