PHD4 (P4HTM) Rabbit Polyclonal Antibody

CAT#: TA344617

Rabbit Polyclonal Anti-PH-4 Antibody - middle region

Product Images

WB Suggested Anti-PH-4 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HT1080 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PH-4 antibody: synthetic peptide directed towards the middle region of human PH-4. Synthetic peptide located within the following region: GHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYLNNVTGG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 57 kDa
• Gene Name: prolyl 4-hydroxylase, transmembrane
• Database Link:
  NP_808808
  Entrez Gene 54681 Human
  UniProt ID Q9NXG6
• Background: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia. It plays a role in adaptation to hypoxia and m
• Synonyms: EGLN4; HIFPH4; P4H-TM; PH-4; PH4; PHD4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Transmembrane