ORC4L (ORC4) Rabbit Polyclonal Antibody
Rabbit Polyclonal Anti-ORC4L Antibody - middle region
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ORC4L antibody: synthetic peptide directed towards the middle region of human ORC4L. Synthetic peptide located within the following region: VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 50 kDa |
Gene Name | origin recognition complex subunit 4 |
Database Link | |
Background | The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves |
Synonyms | ORC4L; ORC4P |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% |
Reference Data | |
Protein Pathways | Cell cycle |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Antibody Resources |
USD 550.00
USD 748.00
USD 169.00