SNAPC5 Rabbit Polyclonal Antibody

SKU TA344536

Rabbit Polyclonal Anti-SNAPC5 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SNAPC5 antibody: synthetic peptide directed towards the N terminal of human SNAPC5. Synthetic peptide located within the following region: KEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 11 kDa
• Gene Name: small nuclear RNA activating complex polypeptide 5
• Database Link:
  NP_006040
  O75971
• Background: SNAPC5 is the part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC5 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TBP and BRF2 to the U6 snRNA TATA box.
• Synonyms: SNAP19
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors