ZNF764 Rabbit Polyclonal Antibody

SKU TA344439

Rabbit Polyclonal Anti-ZNF764 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF764 antibody: synthetic peptide directed towards the N terminal of human ZNF764. Synthetic peptide located within the following region: APPLAPLPPRDPNGAGPEWREPGAVSFADVAVYFCREEWGCLRPAQRALY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: zinc finger protein 764
• Database Link:
  NP_219363
  Q96H86
• Background: ZNF764 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF764 may be involved in transcriptional regulation.
• Synonyms: MGC13138
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 79%

Reference Data

• Protein Families: Transcription Factors