MED14 Rabbit Polyclonal Antibody

SKU TA344438

Rabbit Polyclonal Anti-MED14 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MED14 antibody: synthetic peptide directed towards the middle region of human MED14. Synthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 160 kDa
• Gene Name: mediator complex subunit 14
• Database Link:
  NP_004220
  O60244
• Background: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.
• Synonyms: CRSP2; CRSP150; CSRP; CXorf4; DRIP150; EXLM1; RGR1; TRAP170
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 86%; Mouse: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors