ZNF442 Rabbit Polyclonal Antibody

SKU TA344422

Rabbit Polyclonal Anti-ZNF442 Antibody - middle region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF442 antibody: synthetic peptide directed towards the middle region of human ZNF442. Synthetic peptide located within the following region: YLRHERTHTGEKPYECKHCSKAFPDYSSYVRHERTHTGEKPYKCKRCGRA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 73 kDa
• Gene Name: zinc finger protein 442
• Database Link:
  NP_110451
  Q9H7R0
• Background: ZNF442 Belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF442 may be involved in transcriptional regulation.
• Synonyms: FLJ14356
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Rat: 92%; Horse: 92%; Bovine: 92%; Pig: 86%; Mouse: 86%; Guinea pig: 85%

Reference Data