ROR gamma (RORC) Rabbit Polyclonal Antibody

SKU TA344421

Rabbit Polyclonal Anti-RORC Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RORC antibody is: synthetic peptide directed towards the N-terminal region of Human RORC. Synthetic peptide located within the following region: MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 58 kDa
• Gene Name: RAR related orphan receptor C
• Database Link:
  NP_005051
  P51449
• Background: RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.
• Synonyms: NR1F3; RORG; RZR-GAMMA; RZRG; TOR
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 96%; Mouse: 92%; Rabbit: 92%; Horse: 88%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors