JHDM1D (KDM7A) Rabbit Polyclonal Antibody

CAT#: TA344417

Rabbit Polyclonal Anti-JHDM1D Antibody - middle region

Product Images

WB Suggested Anti-JHDM1D Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: MCF7 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-JHDM1D antibody: synthetic peptide directed towards the middle region of human JHDM1D. Synthetic peptide located within the following region: LDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 106 kDa
• Gene Name: lysine demethylase 7A
• Database Link:
  NP_085150
  Entrez Gene 80853 Human
  UniProt ID Q6ZMT4
• Background: JHDM1D belongs to the JHDM1 histone demethylase family. It contains 1 JmjC domain and 1 PHD-type zinc finger. The function of JHDM1D remains unknown.
• Synonyms: JHDM1D
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 92%; Dog: 85%; Rat: 85%; Mouse: 85%