IMPA2 Rabbit Polyclonal Antibody

SKU TA344407

Rabbit Polyclonal Anti-IMPA2 Antibody - C-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Impa2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Impa2. Synthetic peptide located within the following region: GAFCNGQRLQVSRETDLAKALVLTEIGPKRDPDTLKVFLSNMERLLHAKA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: inositol monophosphatase 2
• Database Link:
  NP_055029
  O14732
• Background: Impa2 can use myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP as substrates. Impa2 has been implicated as the pharmacological target for lithium Li+ action in brain.
• Synonyms: inosine monophosphatase 2; inositol(myo)-1(or 4)-monophosphatase 2; inositol monophosphatase 2 variant 1; inositol monophosphatase 2 variant 2
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 85%

Reference Data

• Protein Pathways: Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system