CDCA5 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Human |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-CDCA5 antibody: synthetic peptide directed towards the middle region of human CDCA5. Synthetic peptide located within the following region: ATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTST |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 28 kDa |
| Gene Name | cell division cycle associated 5 |
| Database Link | |
| Background | CDCA5 is the regulator of sister chromatid cohesion in mitosis. It may act by regulating the ability of the cohesin complex to mediate sister chromatid cohesion, perhaps by altering the nature of the interaction of cohesin with the chromosomes. |
| Synonyms | SORORIN |
| Note | Immunogen Sequence Homology: Human: 100% |
| Reference Data | |
| Protein Categories | Intracellular Proteins |
| Protein Families | Druggable Genome |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
Loss of cell division cycle‑associated 5 promotes cell apoptosis by activating DNA damage response in clear cell renal cell carcinoma
Huang, Huang, Lv et al
Int J Oncol (2022) 61 (1) DOI: 10.3892/ijo.2022.5377
Huang, Huang, Lv et al
Int J Oncol (2022) 61 (1) DOI: 10.3892/ijo.2022.5377
Cited by 18
AI Summary: In this study, the OriGene Technologies, Inc. anti-rabbit secondary antibody (PV-9001) was used for immunohistochemistry to detect CDCA5 expression in tissue samples, enabling the assessment of its clinical and prognostic significance in clear cell renal cell carcinoma.
Snippet: … However, several underlying processes of CDCA5 involved in coordinated chromatin remodeling and tumorigenesis are not yet well characterized. When paired with advanced pathological stages and tumor grade, the expression of CDCA5 lacks a significant association in the majority of these tumors to eff;- Cell division cycle‑associated 5 (CDCA5) protein, which is involved in cohesion, contributes to cell cycle regulation and chromosome segregation by maintaining genomic Save;10 mM citric acid buffer for antigen retrieval and boiled it using a microwave at 100˚C for 15 min. The sides were then incubated with rabbit anti‑CDCA5 antibody overnight at a dilution of 1:200 at 4˚C, followed by incuba‑ tion with secondary anti‑rabbit antibody (PV‑9001, OriGene Technologies, Inc.) at room temperature. …
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Related Products
- Price:
- Actual Price:
Welcome to OriGene AI!
I'm your AI-powered guide to everything OriGene.
Ask me anything:
- Product specs
- Ordering help
- Technical questions
- How to find exactly what your experiment needs
Prefer a live agent? Connect with us by clicking the green chat icon, as seen in the image below or email our team at custsupport@origene.com.
