PGLS Rabbit Polyclonal Antibody

CAT#: TA344307

Rabbit Polyclonal Anti-PGLS Antibody - middle region

Product Images

WB Suggested Anti-PGLS Antibody Titration: 1 ug/ml; Positive Control: 721_B cell lysatePGLS is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

• 

  Immunohistochemistry with Human Colon lysate tissue at an antibody concentration of 5.0 ug/ml using anti-PGLS antibody

• 

  Human Tonsil

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PGLS antibody: synthetic peptide directed towards the middle region of human PGLS. Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: 6-phosphogluconolactonase
• Database Link:
  NP_036220
  Entrez Gene 25796 Human
  UniProt ID O95336
• Background: PGLS belongs to the glucosamine/galactosamine-6-phosphate isomerase family, 6-phosphogluconolactonase subfamily. It is implicated in the hydrolysis of 6-phosphogluconolactone to 6-phosphogluconate.
• Synonyms: 6PGL
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Guinea pig: 93%

Reference Data

• Protein Pathways: Metabolic pathways, Pentose phosphate pathway