BUB3 Rabbit Polyclonal Antibody

SKU TA344273

Rabbit Polyclonal Anti-BUB3 Antibody - N-terminal region

Product Data

• Application: IF, WB
• Recommended Dilution: WB, IF
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BUB3 antibody: synthetic peptide directed towards the N terminal of human BUB3. Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: BUB3, mitotic checkpoint protein
• Database Link:
  NP_001007794
  O43684
• Background: BUB3 is required for kinetochore localization of BUB1.This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Synonyms: BUB3L; hBUB3
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle