Calreticulin 3 (CALR3) Rabbit Polyclonal Antibody

SKU TA344272

Rabbit Polyclonal Anti-CALR3 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CALR3 antibody: synthetic peptide directed towards the N terminal of human CALR3. Synthetic peptide located within the following region: MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: calreticulin 3
• Database Link:
  NP_659483
  Q96L12
• Background: Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum.Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum Persson et al. (2002) [PubMed 12384296]. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-4 BC014595.2 1-4 5-443 DB459545.1 7-445 444-528 BP370084.1 424-508 529-1034 BC014595.2 529-1034 1035-1035 AC008764.9 27895-27895 c 1036-1273 BC014595.2 1036-1273 1274-1285 DB510196.1 313-324
• Synonyms: CMH19; CRT2; CT93
• Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Rat: 92%; Mouse: 92%; Guinea pig: 86%

Reference Data