HDDC2 Rabbit Polyclonal Antibody

SKU
TA344256
Rabbit Polyclonal Anti-HDDC2 Antibody - N-terminal region
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-HDDC2 antibody is: synthetic peptide directed towards the N-terminal region of Human HDDC2. Synthetic peptide located within the following region: ASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMY
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 18 kDa
Gene Name HD domain containing 2
Database Link
Background The function of this protein remains unknown.
Synonyms C6orf74; CGI-130; dJ167O5.2; NS5ATP2
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Write Your Own Review
You're reviewing:HDDC2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.