HDDC2 Rabbit Polyclonal Antibody

CAT#: TA344256

Rabbit Polyclonal Anti-HDDC2 Antibody - N-terminal region

Product Images

Host: Rabbit; Target Name: HDDC2; Sample Tissue: Ovary Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HDDC2 antibody is: synthetic peptide directed towards the N-terminal region of Human HDDC2. Synthetic peptide located within the following region: ASVSSATFSGHGARSLLQFLRLVGQLKRVPRTGWVYRNVQRPESVSDHMY
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: HD domain containing 2
• Database Link:
  NP_057147
  Entrez Gene 51020 Human
  UniProt ID Q7Z4H3
• Background: The function of this protein remains unknown.
• Synonyms: C6orf74; CGI-130; dJ167O5.2; NS5ATP2
• Note: Immunogen Sequence Homology: Human: 100%