LYPD4 Rabbit Polyclonal Antibody

SKU TA344254

Rabbit Polyclonal Anti-LYPD4 Antibody - N-terminal region

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LYPD4 antibody: synthetic peptide directed towards the N terminal of human LYPD4. Synthetic peptide located within the following region: MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 27 kDa
• Gene Name: LY6/PLAUR domain containing 4
• Database Link:
  NP_775777
  Q6UWN0
• Background: The specific function of LYPD4 is not yet known.
• Synonyms: SMR
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 79%; Mouse: 79%

Reference Data