Sarcosine Oxidase (PIPOX) Rabbit Polyclonal Antibody

SKU TA344132

Rabbit Polyclonal Anti-PIPOX Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PIPOX antibody: synthetic peptide directed towards the C terminal of human PIPOX. Synthetic peptide located within the following region: FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: pipecolic acid and sarcosine oxidase
• Database Link:
  NP_057602
  Q9P0Z9
• Background: PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline.
• Synonyms: LPIPOX
• Note: Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Guinea pig: 93%; Zebrafish: 85%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Glycine, Lysine degradation, Metabolic pathways, serine and threonine metabolism