HEXIM2 Rabbit Polyclonal Antibody

SKU
TA343990
Rabbit Polyclonal Anti-HEXIM2 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HEXIM2 antibody: synthetic peptide directed towards the N terminal of human HEXIM2. Synthetic peptide located within the following region: MATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRMES
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 31 kDa
Gene Name hexamethylene bisacetamide inducible 2
Database Link
Background HEXIM2 belongs to the HEXIM family. It is transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor.In cooperation with 7SK snRNA, HEXIM2 sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.
Synonyms L3
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Dog: 93%; Pig: 86%; Horse: 79%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:HEXIM2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.