ADAD2 Rabbit Polyclonal Antibody

SKU TA343988

Rabbit Polyclonal Anti-ADAD2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADAD2 antibody: synthetic peptide directed towards the middle region of human ADAD2. Synthetic peptide located within the following region: GQQLHDCHGLVIARRALLRFLFRQLLLATQGGPKGKEQSVLAPQPGPGPP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 71 kDa
• Gene Name: adenosine deaminase domain containing 2
• Database Link:
  NP_631913
  Q8NCV1
• Background: ADAD2 belongs to the ADAD family, and contains 1 A to I editase domain and 1 DRBM (double-stranded RNA-binding) domain. The exact functions of ADAD2 remain unknown.
• Synonyms: TENRL
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 86%; Rat: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Mouse: 79%

Reference Data